Your Cart
Notice 📦 Loading dispatch date...
Our .com website is temporarily down, and we’re working to restore it as quickly as possible. All orders are still being processed as normal — there’s no impact on dispatch or delivery. For any support queries, please email sales@uk-peptides.co.uk. Thank you for your patience and understanding.

Glow Peptide Blend (Bundle Option)

BPC-157 5mg
BPC-157 5mg
£16.95
+
+
Bundle price: £75.94
You save £0.00!

Add bundle to Cart

Glow Peptide Blend (Bundle Option)

The term "Glow Peptide Blend" is often used online as a marketing phrase to describe a mix of research peptides such as BPC-157, GHK-Cu, and TB-500. While it may sound appealing, combining multiple peptides into a single vial is more of a gimmick than a reliable scientific approach.

Why We Don’t Offer Blended Vials

  • Stability: Certain peptides can degrade faster when mixed together in the same vial.
  • Accuracy: Researchers lose control over the individual dosage of each compound.
  • Transparency: Once peptides are blended, it becomes unclear how much of each compound remains stable over time.

At UK Peptides, we believe in maintaining the highest level of accuracy and quality. For this reason, we supply all peptides in individual vials rather than pre-mixed combinations. This allows researchers to have full control over their work, accurate dosing, and consistent results.

The Glow Peptide Bundle

For those interested in studying the combination often marketed as a Glow Peptide Blend, we have created a convenient bundle option. This includes the following individual products:

  • BPC-157 (5mg)
  • GHK-Cu (50mg)
  • TB-500 (5mg)

By providing each peptide in its own vial, you retain complete flexibility and transparency in your research, avoiding the drawbacks of unstable blended vials.

Important Information

All products are supplied as lyophilised powders and are intended for laboratory research use only. They are not for human consumption, medical, or veterinary use.

BPC-157 5mg - Research Peptide

BPC157, offered at 5mg, is a unique, specialised research peptide developed for advanced scientific exploration in tissue. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: BPC-157 5mg
  • Catalogue Number: BPC5-024
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1479.6 g/mol
  • Purity: 99%
  • Sequence: H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH
  • Form: Lyophilised Solid

Usage and Storage:

BPC-157 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

BPC-157 is meticulously synthesised through a controlled process that guarantees high purity and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards that researchers require.

Why Choose UK Peptides for BPC-157 in the UK?

Since 2012, UK Peptides has been a trusted name in the peptide industry. Our reputation for delivering high-purity peptides suitable for research is backed by over a decade of experience. Unlike many other suppliers, we work directly with our trusted manufacturer, ensuring that each batch meets the highest standards for quality and purity. We do not purchase from third-party resellers, which allows us to maintain consistency, reliability, and unmatched product quality in every vial.

Legal and Safety Information:

UK-Peptides proudly provides BPC-157 strictly for scientific and research use. We are dedicated to supporting the research community and ensuring our products meet stringent quality standards and legal requirements. Please note that our peptides, including BPC-157, are not designed for human consumption or clinical application.

If you require high-quality BPC 157 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

GHK-Cu 50mg - High-Quality Research Peptide 

GHK-Cu, a tripeptide first identified in human blood, is known for its unique property of containing copper molecules, which gives it alternate names such as Copper Peptide Repair Complex, Copper Tripeptide-1, and GHK Copper. The presence of copper (Cu) imbues the compound with a distinctive shade of blue, making it identifiable in research settings.

GHK-Cu, we want to clarify that batch colour variations are normal and do not indicate a quality issue. We have been supplying GHK-Cu for many years, and variations from dark blue to lighter shades occur due to different synthesis and environmental factors. The purity and efficacy remain consistently high across batches, and our testing confirms this.

  • Product Name: GHK-Cu 50mg
  • Catalogue Number: GHK-023
  • CAS Number: 49557-75-7
  • Unit Quantity: 1 vial
  • Unit Size: 50mg
  • Form: Lyophilised Solid

Usage and Storage:

GHK-Cu is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For optimal results, consult our website for detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

This peptide is meticulously synthesised through a controlled process that ensures high purity, making it suitable for advanced scientific studies. Our commitment to excellence guarantees that each batch undergoes stringent quality control.

Legal and Safety Information:

UK-Peptides provides GHK-Cu strictly for scientific and research use. Our products meet stringent quality standards and comply with all legal requirements. Note: Our peptides, including GHK-Cu, are not intended for human consumption or clinical applications.

Important: UK-Peptides products are sold strictly for research purposes only. Inquiry regarding human consumption is strictly prohibited.

TB-500 5mg - High-Quality Research Peptide

TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular regeneration and tissue repair. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: TB-500 5mg
  • Catalogue Number: TB500-5mg
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity: ≥98%
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Solid

Usage and Storage:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.